PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 76aa    MW: 8968.22 Da    PI: 5.4839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023413.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM29.32.4e-092974248
          NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                 p  +rF  td+el+ +yL +k  +++l++ + + +v+iy+++P++L 
  Pbr023413.1 29 PLRYRFVLTDDELILHYLMRKFMNEQLPI-NRFLNVNIYQHHPRELT 74
                 55689************************.67999**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-112475IPR003441NAC domain
PROSITE profilePS5100513.2232875IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MEENNQFNNN MVPVLNEVGS VDAHIDSLPL RYRFVLTDDE LILHYLMRKF MNEQLPINRF  60
LNVNIYQHHP RELTG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334972.11e-29PREDICTED: NAC domain-containing protein 67-like
TrEMBLM5W2D06e-14M5W2D0_PRUPE; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.19e-09NAC domain containing protein 47